Protein Info for ABZR86_RS19900 in Dyella japonica UNC79MFTsu3.2

Annotation: hemolysin family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 56 to 76 (21 residues), see Phobius details amino acids 99 to 122 (24 residues), see Phobius details amino acids 134 to 156 (23 residues), see Phobius details PF01595: CNNM" amino acids 7 to 199 (193 residues), 164.3 bits, see alignment E=3.5e-52 PF00571: CBS" amino acids 282 to 332 (51 residues), 29.3 bits, see alignment 1.3e-10 PF03471: CorC_HlyC" amino acids 351 to 429 (79 residues), 70.6 bits, see alignment E=1.3e-23

Best Hits

KEGG orthology group: K03699, putative hemolysin (inferred from 53% identity to xcc:XCC1689)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2HZP1 at UniProt or InterPro

Protein Sequence (440 amino acids)

>ABZR86_RS19900 hemolysin family protein (Dyella japonica UNC79MFTsu3.2)
MLTEIATVFVLALANGFFALSEMALVASRKSRLKQMAKSSRRARVALRHAEAPEHFLSTV
QVGMTLVILVTGAIAGDALGDHIAEALHGGQAAWLEPYAKVIGLVLGFALISFIQIVIGE
LVPKRLALSAPEKVSGFVAMPMLVLSRIAAPFVWLLNFSSTQLLRLLRVAQRSRDAVTEE
EIRLLVAESAEQGVLDADEHNMVNRVLRLGDRTVDSVMTPRTRIAWLDMSAAPEENDEVL
RDTPYSRYPVYRGDESDVAGVVEVKHLLRNFRHGSPDLFGRMAKPLFVPATARALDLLEE
FRDAETQLALVVDEYGDIEGLVTLNDLLSAVVGASQRSSQGGEETAPIVPREDGSWLVDG
SISTDDLRELLHVDHLPGEQEHEYRTAAGMVMAVLGHIPQTGEVFAWQGIRFEVVDLDGA
RIDKLLITPARRDEPADDEQ