Protein Info for ABZR86_RS19875 in Dyella japonica UNC79MFTsu3.2

Annotation: CDP-alcohol phosphatidyltransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01066: CDP-OH_P_transf
  • amino acids 12 to 162 (151 residues), 101.4 bits, E=3.3e-33

Best Hits

KEGG orthology group: K00995, CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase [EC: 2.7.8.5] (inferred from 45% identity to nhl:Nhal_0875)

Predicted SEED Role

"CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.5)

MetaCyc Pathways

• phosphatidylglycerol biosynthesis I (6/6 steps found)
• phosphatidylglycerol biosynthesis II (6/6 steps found)
• superpathway of phospholipid biosynthesis III (E. coli) (10/12 steps found)
• cardiolipin biosynthesis II (3/3 steps found)
• cardiolipin biosynthesis I (2/3 steps found)
• cardiolipin biosynthesis III (2/3 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (9/13 steps found)
• type I lipoteichoic acid biosynthesis (S. aureus) (5/17 steps found)
• superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.5

Use Curated BLAST to search for 2.7.8.5

Sequence Analysis Tools

See A0A1I2HY39 at UniProt or InterPro

Protein Sequence (187 amino acids)

>ABZR86_RS19875 CDP-alcohol phosphatidyltransferase family protein (Dyella japonica UNC79MFTsu3.2)
MPGQPQLSPWRHLPNAITLLRILLVPPIGWAILAREPRLALGLIALAGFTDGLDGFLARR
CGWQSRLGGILDAAADKLLLVTCFVLLAVIGLAPWWLAALVCGRDAVIALGALAWRWLIG
PLRPQPSLVSKACTLLQILYLLGVLAADLGWPVPPMLPLAWLVAALCLASGADYVWRWSR
RARAALR