Protein Info for ABZR86_RS19860 in Dyella japonica UNC79MFTsu3.2
Annotation: phosphoribosylglycinamide formyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 40% identical to PUR3_MYCTO: Phosphoribosylglycinamide formyltransferase (purN) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
KEGG orthology group: K11175, phosphoribosylglycinamide formyltransferase 1 [EC: 2.1.2.2] (inferred from 56% identity to ttu:TERTU_3014)Predicted SEED Role
"Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2)" in subsystem De Novo Purine Biosynthesis (EC 2.1.2.2)
MetaCyc Pathways
- superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
- 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
- superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
- superpathway of 5-aminoimidazole ribonucleotide biosynthesis (5/6 steps found)
- tetrahydrofolate salvage from 5,10-methenyltetrahydrofolate (2/2 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.1.2.2
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1I2HXI9 at UniProt or InterPro
Protein Sequence (221 amino acids)
>ABZR86_RS19860 phosphoribosylglycinamide formyltransferase (Dyella japonica UNC79MFTsu3.2) MSSPLRIAVLASGRGSNLQALIAARDAGTLPVEFVLVGSDKASAGALELAQAAGIPRLAL NPKAYPSRRDFDLDLFARIEATGAELLVLAGYMRILDGEALHPWVGRMINIHPSLLPKYR GLHTHRRALEAGDLEHGASVHYVTAELDGGPVIAQARIGIEAGDHEDLLAQRLLAYEHRL LPAVVRLIAASRLAYAAPDGVALDGERLSAPLELRGDELRR