Protein Info for ABZR86_RS19845 in Dyella japonica UNC79MFTsu3.2

Annotation: BolA/IbaG family iron-sulfur metabolism protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 79 PF01722: BolA" amino acids 24 to 74 (51 residues), 63.5 bits, see alignment E=9.1e-22

Best Hits

Swiss-Prot: 43% identical to Y3122_SYNY3: Uncharacterized protein ssr3122 (ssr3122) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: None (inferred from 75% identity to psu:Psesu_1071)

Predicted SEED Role

"Cell division protein BolA" in subsystem Bacterial Cell Division

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2HZB3 at UniProt or InterPro

Protein Sequence (79 amino acids)

>ABZR86_RS19845 BolA/IbaG family iron-sulfur metabolism protein (Dyella japonica UNC79MFTsu3.2)
MDAATIQAMIEQGLPGAQAQVSGDDGVHFEAEVVAAQFAGKLPLARHRLVYGTLGELMGG
AIHALALKTLTPEEAAARR