Protein Info for ABZR86_RS19815 in Dyella japonica UNC79MFTsu3.2

Annotation: RNA polymerase factor sigma-54

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 PF00309: Sigma54_AID" amino acids 5 to 48 (44 residues), 56 bits, see alignment 4.4e-19 TIGR02395: RNA polymerase sigma-54 factor" amino acids 9 to 483 (475 residues), 480.5 bits, see alignment E=2.8e-148 PF04963: Sigma54_CBD" amino acids 119 to 313 (195 residues), 183 bits, see alignment E=7.7e-58 PF04552: Sigma54_DBD" amino acids 326 to 484 (159 residues), 235.7 bits, see alignment E=3.2e-74

Best Hits

Swiss-Prot: 50% identical to RP54_AZOVI: RNA polymerase sigma-54 factor (rpoN) from Azotobacter vinelandii

KEGG orthology group: K03092, RNA polymerase sigma-54 factor (inferred from 50% identity to avn:Avin_12790)

Predicted SEED Role

"RNA polymerase sigma-54 factor RpoN" in subsystem Flagellar motility or Flagellum or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2I1Z7 at UniProt or InterPro

Protein Sequence (486 amino acids)

>ABZR86_RS19815 RNA polymerase factor sigma-54 (Dyella japonica UNC79MFTsu3.2)
MKPGLQFRLNQQLTLTPQLQQAIRLLQLSQLELEAELRQIAESNPLLEFSEDAANEGDGE
SDGEAASFDAPAEAATSANDGDSGDEPADWSESGGSAEEPIDFSSAGGSRSSGGDEDHFE
PQNAAPETLQEHLLWQLNLTHLSLRERTIAAIIIDALNADGYLGETLESVTAAVPADLKA
TVEEVDAVRRQVQRFDPTGVASLDLRDCLRVQLEQFDPELPQRELALRIVDSELELLARN
DIVRLSRRLRASEEETHAATVLIRSLDPRPGAALDVTPVEYVAPDVYARKDGGRWRVSLN
PDCQPRLGLNQHYCNLIAQARGEDASWMRGQLQEARWLIKSLESRAETLLKVAEAIVRRQ
SAFLDYGPEAMHPLVLREVAEEVGMHESTISRVTTRKYIHTPRGTFELKHFFSSGVSTED
GGSASATAIQAMLRKLIDAEDPRKPLSDQAIAEELHRKGIQVARRTVAKYREAMRIPSSS
ERQRAG