Protein Info for ABZR86_RS19805 in Dyella japonica UNC79MFTsu3.2

Annotation: HPr(Ser) kinase/phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 TIGR00679: HPr(Ser) kinase/phosphatase" amino acids 9 to 310 (302 residues), 340 bits, see alignment E=5.9e-106 PF02603: Hpr_kinase_N" amino acids 16 to 131 (116 residues), 81.1 bits, see alignment E=7.2e-27 PF07475: Hpr_kinase_C" amino acids 134 to 305 (172 residues), 202.5 bits, see alignment E=3.7e-64

Best Hits

Swiss-Prot: 67% identical to HPRK_XANC5: HPr kinase/phosphorylase (hprK) from Xanthomonas campestris pv. vesicatoria (strain 85-10)

KEGG orthology group: K06023, HPr kinase/phosphorylase [EC: 2.7.11.- 2.7.4.-] (inferred from 67% identity to xcv:XCV3121)

Predicted SEED Role

"HPr kinase/phosphorylase (EC 2.7.1.-) (EC 2.7.4.-)" in subsystem Mannitol Utilization (EC 2.7.1.-, EC 2.7.4.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-, 2.7.4.-

Use Curated BLAST to search for 2.7.1.- or 2.7.11.- or 2.7.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2HXC3 at UniProt or InterPro

Protein Sequence (316 amino acids)

>ABZR86_RS19805 HPr(Ser) kinase/phosphatase (Dyella japonica UNC79MFTsu3.2)
MDRLTARQLYDGVHERMALRWVAGMRGESRVLERGVTASRRPSLIGYLNVIYPNKIQIIG
TEELNYLDSLDSRQRWEAINKIAAYQPVAMIVTKDQAIPSDLREVAEETNTPLWISSKRG
HELFTWMQYHLARMLAPKVTLHGVFLEVFSIGVLITGESGSGKSELALELISRGHRLVAD
DATEFTLIAPDVIDGTCPELLQDLLEVRGLGVLNVREMFGHTAVKPSKYLRLVVHLKPMR
EGEDTDGLTRLTGDVGHRDIFEVPVPMITIPVAPGRNLAVLVEAAVRNHMLKSKGIDPAQ
TFIDRQAHQMRRLPPW