Protein Info for ABZR86_RS19795 in Dyella japonica UNC79MFTsu3.2

Annotation: PTS sugar transporter subunit IIA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 130 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details PF03610: EIIA-man" amino acids 4 to 108 (105 residues), 56.3 bits, see alignment E=1.7e-19

Best Hits

KEGG orthology group: K02821, PTS system, ascorbate-specific IIA component [EC: 2.7.1.69] (inferred from 50% identity to xal:XALc_2144)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2I0A4 at UniProt or InterPro

Protein Sequence (130 amino acids)

>ABZR86_RS19795 PTS sugar transporter subunit IIA (Dyella japonica UNC79MFTsu3.2)
MSVGVLLMTHEAVGQALISAAHHVLPKLPLQVEAVEVPPSADPDVMRTLTAKHARDLDTG
DGVLVLADLYGATPCNIGLSLGKLGVHLRCVSGLNLPMLLRVLNYAEKPLDELAEVAASG
GRGGIFIDHA