Protein Info for ABZR86_RS19755 in Dyella japonica UNC79MFTsu3.2

Annotation: RNA polymerase sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 PF04542: Sigma70_r2" amino acids 23 to 79 (57 residues), 40.2 bits, see alignment 3.7e-14 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 26 to 172 (147 residues), 53.7 bits, see alignment E=9.3e-19 PF08281: Sigma70_r4_2" amino acids 121 to 170 (50 residues), 37.8 bits, see alignment 1.8e-13 PF20239: DUF6596" amino acids 188 to 288 (101 residues), 122.2 bits, see alignment E=1.6e-39

Best Hits

KEGG orthology group: None (inferred from 78% identity to scl:sce6417)

Predicted SEED Role

"RNA polymerase sigma-70 factor, ECF subfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2I0A8 at UniProt or InterPro

Protein Sequence (419 amino acids)

>ABZR86_RS19755 RNA polymerase sigma factor (Dyella japonica UNC79MFTsu3.2)
MTASHIHRTIDAVWRIESAKLIAGLARMVRDVGLAEELAQDALVAALEQWPTGGVPDNPG
AWLMTTAKHRAIDRLRRHKLQERKHEEIGRDLELDQEPAYSEVELAADDHIGDDMLRLVF
TACHPVLSMDARVALTLRLLGGLTTDEIARAFLVPEATVAQRIVRAKRTLAEAKVPFEVP
RGEELHERLGSVLGVIYLIFNEGYSATAGDDWMRPALCDEALRLGRVLAELAPREPEVHG
LAALMEIQASRAKARTGPTGEPILLLEQNRAQWDRLLIRRGLASLERAERLSEQRGIYTS
QAAIAACHARARTAEATDWRRIATLYAELAQIAPSPVVELNRAVAVSMAAGPAAALAIVE
GLVSEPSLKNYHLLPSVRGDLLRKLGRTEEAKREFERAASLTRNAREKDLLLERARACE