Protein Info for ABZR86_RS19710 in Dyella japonica UNC79MFTsu3.2

Annotation: glycosyltransferase family 2 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 867 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 322 to 341 (20 residues), see Phobius details amino acids 353 to 374 (22 residues), see Phobius details amino acids 383 to 405 (23 residues), see Phobius details amino acids 691 to 715 (25 residues), see Phobius details amino acids 726 to 747 (22 residues), see Phobius details amino acids 759 to 776 (18 residues), see Phobius details amino acids 811 to 831 (21 residues), see Phobius details amino acids 837 to 859 (23 residues), see Phobius details PF00332: Glyco_hydro_17" amino acids 220 to 310 (91 residues), 38 bits, see alignment E=3.9e-13 PF13641: Glyco_tranf_2_3" amino acids 434 to 661 (228 residues), 80.8 bits, see alignment E=3.6e-26 PF00535: Glycos_transf_2" amino acids 435 to 605 (171 residues), 88 bits, see alignment E=1.8e-28 PF13506: Glyco_transf_21" amino acids 518 to 659 (142 residues), 34.9 bits, see alignment E=2.7e-12 PF13632: Glyco_trans_2_3" amino acids 522 to 726 (205 residues), 91.9 bits, see alignment E=1.3e-29

Best Hits

KEGG orthology group: None (inferred from 53% identity to azo:azo1282)

Predicted SEED Role

"probable glucosyl transferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2JU89 at UniProt or InterPro

Protein Sequence (867 amino acids)

>ABZR86_RS19710 glycosyltransferase family 2 protein (Dyella japonica UNC79MFTsu3.2)
MTATDAAATHPSRPTLFSAILLALIVAALNVGLWWWGNLPHGPNDWKGPIGGFALSAFQR
YQNPLKNDFPSEDEIESDLKLLSRYTSRIRTYSTLQNPQVHRLAEREGLDVMAGAWMDRR
LDNNELELEALIAQARRYPNSITRVIVGNEVLFRGDLTPEQLMAYADRARAALKQPVSIA
EPWHIWAKYPELADHVDFITVHLFPYWNGVSREAAIGEAMDSFKALQRLFPNKHIVIGEI
GWPSNGDRFQYAQPSVSDEAIFLRNWFNAAKQQKIDYYVMEAFDQPWKEKLAGRTEAYWG
MFNADRQPKFPFTGPVTEDTGWPWKAIAAGLLALLPMVWFGRRFGRFKLMGRFFFAALIQ
LACGLVVWSATLPFNFYLSWIDWTMLVLLFPAQIAILAILLINGFEFTEVLWRRSWVRHA
GMLRPDPPARQPFVSIHLACYNEPPEMVIVTLDSLAALEYENYEVLVIDNNTKDPAIWQP
VQEYCEKLGHRFRFFHLEPWPGFKAGALNFGLKETDPRADVVAVIDADYVVRQDWLATLT
GHFHDPKVAVVQCPQAHRDFEHNRFRRMTAWEYDGFFRIGMHHRNERNAIIQHGTMTMVR
RSALEGTGGWSEWTICEDAELGLRLMHAGYELVYVDELMGKGLTPADFKAYKSQRYRWAF
GAMQILKGRWDWMTHKGPLSAGQRFHFLTGWFSWFADALHLIFTLMAIFWTAGMVAAPKL
FTLPMQLFLIPVIGFFFAKAIFGIVLYRARVPCSWYDTLMASLASMGLSHAIARGILHGL
TREKTSFVVTAKSRRLGGSNFAAFAPVREEMLMAIALLLCVVGMGMAYGTYYVESTLWMF
ILGAQSIPYVSAVVGAWIAHKAGDKAG