Protein Info for ABZR86_RS19585 in Dyella japonica UNC79MFTsu3.2

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00583: Acetyltransf_1
  • amino acids 30 to 129 (100 residues), 55.5 bits, E=1.1e-18
• PF13673: Acetyltransf_10
  • amino acids 43 to 134 (92 residues), 27 bits, E=5.9e-10
• PF13508: Acetyltransf_7
  • amino acids 47 to 129 (83 residues), 39.7 bits, E=7.8e-14

Best Hits

Swiss-Prot: 64% identical to YSNE_BACSU: Uncharacterized N-acetyltransferase YsnE (ysnE) from Bacillus subtilis (strain 168)

KEGG orthology group: K03829, putative acetyltransferase [EC: 2.3.1.-] (inferred from 70% identity to hch:HCH_05117)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

See A0A1I2JKJ9 at UniProt or InterPro

Protein Sequence (151 amino acids)

>ABZR86_RS19585 GNAT family N-acetyltransferase (Dyella japonica UNC79MFTsu3.2)
MQIRLDDLTDPRIIDLLGEHLRDMARHSPPESIHALDLDGLRRPELSFWTVWDGEDLLGC
GALKQLDAGHGEIKSMRTANAHRRRGVAAVMLRHIVDEAAARSYRRLSLETGSMAAFEPA
RKLYASFGFAFCGPFADYVDDPNSVFMTRLL