Protein Info for ABZR86_RS19540 in Dyella japonica UNC79MFTsu3.2

Annotation: peptidase domain-containing ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 701 transmembrane" amino acids 156 to 180 (25 residues), see Phobius details amino acids 192 to 213 (22 residues), see Phobius details amino acids 225 to 238 (14 residues), see Phobius details amino acids 271 to 291 (21 residues), see Phobius details amino acids 295 to 313 (19 residues), see Phobius details amino acids 393 to 418 (26 residues), see Phobius details PF03412: Peptidase_C39" amino acids 3 to 129 (127 residues), 113.1 bits, see alignment E=1.3e-36 PF00664: ABC_membrane" amino acids 159 to 422 (264 residues), 113.2 bits, see alignment E=2.8e-36 PF00005: ABC_tran" amino acids 488 to 637 (150 residues), 117.2 bits, see alignment E=1.3e-37

Best Hits

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 68% identity to psu:Psesu_1940)

Predicted SEED Role

"colicin V secretion ABC transporter ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2JFK6 at UniProt or InterPro

Protein Sequence (701 amino acids)

>ABZR86_RS19540 peptidase domain-containing ABC transporter (Dyella japonica UNC79MFTsu3.2)
MEAIVQTETGECGLACLAMIAAAHGQRIGLFELRRRFPASLRGMNLLRLMHVAEQIQMQG
RPLRLELEQLDRLSLPCILHWDLNHYVVLAKVKRDRLTVHDPAAGKRTLPRTEASKHFTG
IALELTPTSTFQPRRALPRISVLQLTGRISGLYRAITPILLLSVALQVFVLLAPFFMQWV
VDQVLVTADRDLLAVLGLGFSLALLLQLGIGLLRGWSVIYLSTRLGFQWMGNVFAHLLRL
PLDFFQKRHLGDITSRMGAVQAIQQTLTTHFVEAFIDGLMAVVTLGMMLLYSAKLALVTL
LAATLYLSLRWLVYGPLRAGTERQLVAAALQQTHLLESIRGIQSVKVAGCESVRRSRHAN
LMQDTLNSEVCLARLGLGFNSASQLIFGAERIAVIWIGAVLALSDAFSVGMLVAYLAYKD
QFAQRVATLIDKWVEFRMLRLHGERLADIALAEPEADQGRSEPAMPEHARLEVTGLGFRY
AEGEPWVLKDCSFAVEDGESLAIVGPSGCGKTTLMKLLLGLLPATAGSILIDGEDLQRLG
PRHFRRWVGAVMQEDQLFAASLAENIAFGDDGYDLRCVEDAARRAGVHQEIEAMPMGYHS
LIGDMGTTLSGGQKQRVILARALYRNPRFLFLDEATSHLDVERERLVNEAVGALKMTRII
IAHRPETIASADRVLVLHGGRIAKEWRPPPRPAQAMPTGPA