Protein Info for ABZR86_RS19440 in Dyella japonica UNC79MFTsu3.2

Annotation: acyl-CoA dehydrogenase C-terminal domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 591 PF12418: AcylCoA_DH_N" amino acids 4 to 34 (31 residues), 33.7 bits, see alignment (E = 9.1e-12) PF02771: Acyl-CoA_dh_N" amino acids 82 to 159 (78 residues), 38.7 bits, see alignment E=3.4e-13 PF02770: Acyl-CoA_dh_M" amino acids 165 to 274 (110 residues), 61.4 bits, see alignment E=2.3e-20 PF00441: Acyl-CoA_dh_1" amino acids 285 to 452 (168 residues), 63.4 bits, see alignment E=8.7e-21 PF08028: Acyl-CoA_dh_2" amino acids 396 to 445 (50 residues), 23.2 bits, see alignment 2.1e-08 PF12806: Acyl-CoA_dh_C" amino acids 469 to 587 (119 residues), 90.6 bits, see alignment E=2.6e-29

Best Hits

KEGG orthology group: None (inferred from 61% identity to sml:Smlt3352)

Predicted SEED Role

"Acyl-CoA dehydrogenase (EC 1.3.8.7)" (EC 1.3.8.7)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.8.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2IEA5 at UniProt or InterPro

Protein Sequence (591 amino acids)

>ABZR86_RS19440 acyl-CoA dehydrogenase C-terminal domain-containing protein (Dyella japonica UNC79MFTsu3.2)
MTIYKAPLDDLRFALYDVLHAEATLTQLQGGEGHTRDLLDAVLEEAGRLSEALLAPFNAS
GDEEGCKYDKATQTVTTPKGFKEAFKAFAEGGWTGLTQAEHFGGQGLPNTVGTATTEIFQ
AGNLSWSLYPLLSEGACHAMELHGTKEQQDTYLKPIVEGRWTGTMCLTEPQAGSDLGLLK
TRAEPGDNGSYKITGTKIFISAGEHDLAENIIHLVLARLPDAPAGSRGISMFIVPKFKLN
ADGSPGTRNTVVASNIEHKMGLRGSATCVMNFDAAEGYLIGQPHKGLAAMFTMMNAARLG
VGVQGLALSERALQNSSNYARERLQGRALSGPQFPDKPADNLLVQPDVRRMLLTQRAIVE
GSRTLLLYTSLQTDVEARGVDEVTRKNAGELVAFLIPIAKGLVTELAQESTKEALQVYGG
HGYIVESGVEQFVRDARIITLYEGTTGIQAADLLGRKILQLQGAGFKLFLQEIQAFCQKH
AQDAAMASLIAPLARNAKEWADLTLAVAARVQGNPEELGAAASDYLYYSGYATLAYMWAR
SVAAANASSQSEAFKQSKRDTAAFYFARMLPRCLMHKAAIEAGVGTLPAVA