Protein Info for ABZR86_RS19420 in Dyella japonica UNC79MFTsu3.2

Annotation: TolC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details PF02321: OEP" amino acids 83 to 256 (174 residues), 59.4 bits, see alignment E=2.2e-20 amino acids 283 to 455 (173 residues), 57 bits, see alignment E=1.2e-19

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2ICH7 at UniProt or InterPro

Protein Sequence (479 amino acids)

>ABZR86_RS19420 TolC family protein (Dyella japonica UNC79MFTsu3.2)
MRYVSLLRRRSGGFRATGVAVVLVLAGCAHYQARPIDPAVTAAQWQARRLDDPMLAERLA
PVLREAQLDWPPARYGSGELLLAALVLNPDLAEARAHLAEADAAVRTAKAWPKPSVNLAL
ERYAQDQAGSSPWLWGVTTNWLIDTAVRRRLRADLADAGVRGARLDYAGKVWDVRRTLRA
ALADVLLGERQRALADEAVNKAMALQAAQEQRRALGEAMPADVLQVALVLAQARDAAAAA
AQRVADARARLARAVGVPVQALEGVALAWDDLEAPPEWPATQLDALASRARLSRPDLERA
LVDYASRETELRQQVRMQYPQISIGPGYTYDHGARKLQFNLGATLPLLDQNQGPIAEAEA
RREAAGRHVEAVQAGIDSEIASAAARLTAARDALNAATHGHDAAERLRQQVETGYAHGED
DRVAVLNAQLAAITATQARLTAVDQAQQALGALEDAVRTPLEGNEAGLLQAAGRAGDKP