Protein Info for ABZR86_RS19370 in Dyella japonica UNC79MFTsu3.2

Annotation: peptide chain release factor N(5)-glutamine methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00536: methyltransferase, HemK family
  • amino acids 8 to 270 (263 residues), 261.8 bits, E=6.5e-82
• PF17827: PrmC_N
  • amino acids 11 to 70 (60 residues), 64.4 bits, E=5.3e-21
• TIGR03534: protein-(glutamine-N5) methyltransferase, release factor-specific
  • amino acids 20 to 269 (250 residues), 311.4 bits, E=4.5e-97
• PF05175: MTS
  • amino acids 98 to 187 (90 residues), 64.3 bits, E=4.9e-21
• PF06325: PrmA
  • amino acids 100 to 181 (82 residues), 27.9 bits, E=7.6e-10
• PF01209: Ubie_methyltran
  • amino acids 106 to 167 (62 residues), 22.3 bits, E=3.5e-08
• PF13847: Methyltransf_31
  • amino acids 108 to 182 (75 residues), 51.4 bits, E=4.9e-17
• PF13649: Methyltransf_25
  • amino acids 111 to 181 (71 residues), 44.2 bits, E=1.2e-14
• PF08241: Methyltransf_11
  • amino acids 112 to 181 (70 residues), 31.7 bits, E=9.1e-11
• PF01170: UPF0020
  • amino acids 124 to 188 (65 residues), 23 bits, E=2.7e-08

Best Hits

Swiss-Prot: 65% identical to PRMC_XANCP: Release factor glutamine methyltransferase (prmC) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K02493, methyltransferase [EC: 2.1.1.-] (inferred from 68% identity to smt:Smal_0690)

MetaCyc: 48% identical to protein-(glutamine-N5) methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-14992 [EC: 2.1.1.297]

Predicted SEED Role

"Protein-N(5)-glutamine methyltransferase PrmC, methylates polypeptide chain release factors RF1 and RF2"

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.297

Sequence Analysis Tools

See A0A1I2IEW1 at UniProt or InterPro

Protein Sequence (273 amino acids)

>ABZR86_RS19370 peptide chain release factor N(5)-glutamine methyltransferase (Dyella japonica UNC79MFTsu3.2)
MVDVRGALAAATRRLGERIDAEALLLHVLDKPRSWLVAHDTDVLDDQIRAAFEAMVARRE
AGEPVAYITGRRGFWSLELEVTPATLIPRPETELVVELALERLPPDRPARVVDLGTGSGA
IALAIAKERPRAAVTAVDLSADALAVARGNARRLGLERVRFLHGTWMTPLSGERFELIVS
NPPYIEAADPHLGQGDLRFEPATALASGADGLDAIREIVAAAPAHLEAGGWLLLEHGWDQ
GAAVRALLDQAGYAEVFTATDLEGRDRVSGGRR