Protein Info for ABZR86_RS19355 in Dyella japonica UNC79MFTsu3.2

Annotation: DNA-binding transcriptional regulator OxyR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 PF00126: HTH_1" amino acids 3 to 62 (60 residues), 81.4 bits, see alignment E=3.8e-27 PF03466: LysR_substrate" amino acids 87 to 292 (206 residues), 184.3 bits, see alignment E=2e-58

Best Hits

Swiss-Prot: 42% identical to OXYR_MYCMR: Probable hydrogen peroxide-inducible genes activator (oxyR) from Mycobacterium marinum

KEGG orthology group: K04761, LysR family transcriptional regulator, hydrogen peroxide-inducible genes activator (inferred from 68% identity to psu:Psesu_2387)

Predicted SEED Role

"Hydrogen peroxide-inducible genes activator" in subsystem DNA-binding regulatory proteins, strays or Oxidative stress or Thioredoxin-disulfide reductase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2IF31 at UniProt or InterPro

Protein Sequence (316 amino acids)

>ABZR86_RS19355 DNA-binding transcriptional regulator OxyR (Dyella japonica UNC79MFTsu3.2)
MNLRDLQYLVALAEHRHFGRAAEASFVSQPTLSTQIKKLEDELGVPLVERTPRKVLLTET
GREIARRARGVLSEVDEIKAIAQRTRDPESGTLRLGIFPTLGPYLLPHLVPLVRQRFPRL
ELLLVEEKTEQVIRMLREGSLDVGVLALPLHEDSLHTEFLFEEPFVLAVPENHPLAHKKH
RLKLGDLEDESLLLLEDGHCLRDQALEVCQLAGAGERSGFRATSLETLRQMVAANVGITL
LPTLAIKPPVARTDNVHLVEFAGHPPSRRIALVWRKSSSTGTFLKRFAEVIRGMPPELLR
PELNGAKPANRPRAST