Protein Info for ABZR86_RS19335 in Dyella japonica UNC79MFTsu3.2

Annotation: adenine phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01090: adenine phosphoribosyltransferase
  • amino acids 9 to 176 (168 residues), 206.2 bits, E=1.9e-65
• PF00156: Pribosyltran
  • amino acids 56 to 154 (99 residues), 57.8 bits, E=4.1e-20

Best Hits

Swiss-Prot: 53% identical to APT_ACIC5: Adenine phosphoribosyltransferase (apt) from Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161)

KEGG orthology group: K00759, adenine phosphoribosyltransferase [EC: 2.4.2.7] (inferred from 61% identity to psu:Psesu_1446)

MetaCyc: 49% identical to adenine phosphoribosyltransferase (Sinorhizobium meliloti 1021)
Adenine phosphoribosyltransferase. [EC: 2.4.2.7]

Predicted SEED Role

"Adenine phosphoribosyltransferase (EC 2.4.2.7)" in subsystem Purine conversions or cAMP signaling in bacteria (EC 2.4.2.7)

MetaCyc Pathways

• superpathway of purine nucleotide salvage (12/14 steps found)
• adenine and adenosine salvage II (2/2 steps found)
• guanine and guanosine salvage II (2/2 steps found)
• adenine salvage (2/3 steps found)
• adenine and adenosine salvage I (1/2 steps found)
• guanine and guanosine salvage I (1/2 steps found)
• superpathway of guanine and guanosine salvage (1/3 steps found)
• glyphosate degradation III (2/7 steps found)
• (aminomethyl)phosphonate degradation (2/8 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.7

Sequence Analysis Tools

See A0A1I2IDE8 at UniProt or InterPro

Protein Sequence (176 amino acids)

>ABZR86_RS19335 adenine phosphoribosyltransferase (Dyella japonica UNC79MFTsu3.2)
MESNLRQIEALIRAVPDFPQPGVVFRDITPLLADAGGFARCIDALAEPWQGSGVQAVCGI
ESRGFIFGAALAQKLHAGFVPLRKPNKLPPPVVSVDYALEYGKDRLEARNDALRPGERVL
IVDDVLATGGTLDAACRLVETLGAVRVGASVVIELEALQGRHRLPGNTPLHALLRY