Protein Info for ABZR86_RS19325 in Dyella japonica UNC79MFTsu3.2

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 30 to 49 (20 residues), see Phobius details amino acids 69 to 93 (25 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 135 to 158 (24 residues), see Phobius details PF05230: MASE2" amino acids 3 to 91 (89 residues), 103 bits, see alignment E=7.5e-34 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 169 to 333 (165 residues), 166.3 bits, see alignment E=2.5e-53 PF00990: GGDEF" amino acids 175 to 330 (156 residues), 154.6 bits, see alignment E=2e-49

Best Hits

KEGG orthology group: None (inferred from 38% identity to pfo:Pfl01_4307)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2IFD8 at UniProt or InterPro

Protein Sequence (348 amino acids)

>ABZR86_RS19325 diguanylate cyclase (Dyella japonica UNC79MFTsu3.2)
MTRVYRLRLLGLGLGALPVASVLYQLHAAWWLWGLLAVNALVWPHLAYLRSTRSPRPIEA
EHAHLVIDAAIGGAWVALMQFNLLPSALLVAMMAMDRISAGGLRLVLKSLALQVAVCLAV
WWLDGFRLQPVSTTLNVMASIPMLVIYPVWMSMVNFTLTQRVRQQNRQLDQLSRTDALTG
LNNRNHWLEAVGVEWLRYQRNQRPAALILLDVDGFKQINDRYGHAAGDQLLGDLARLLQR
GLRDVDTPGRLGGDEFGIVLPETDLERASAVAERIRLLAENSRPERSDQHIPWTISLGVA
SVGEDARDVGAWMRQADLALYRAKAQGRNRVCVAPARGGGSRVAPTPA