Protein Info for ABZR86_RS19245 in Dyella japonica UNC79MFTsu3.2

Annotation: glycosyltransferase family 2 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 262 to 280 (19 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 11 to 227 (217 residues), 66.4 bits, see alignment E=9e-22 PF00535: Glycos_transf_2" amino acids 12 to 139 (128 residues), 87.6 bits, see alignment E=2.3e-28 PF10111: Glyco_tranf_2_2" amino acids 23 to 208 (186 residues), 27.6 bits, see alignment E=5.1e-10 PF13506: Glyco_transf_21" amino acids 80 to 222 (143 residues), 22.4 bits, see alignment E=2e-08 PF13632: Glyco_trans_2_3" amino acids 92 to 254 (163 residues), 27.4 bits, see alignment E=7.5e-10

Best Hits

Predicted SEED Role

"dTDP-Rha:A-D-GlcNAc-diphosphoryl polyprenol, A-3-L-rhamnosyl transferase WbbL" in subsystem dTDP-rhamnose synthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2IE99 at UniProt or InterPro

Protein Sequence (298 amino acids)

>ABZR86_RS19245 glycosyltransferase family 2 protein (Dyella japonica UNC79MFTsu3.2)
MNSAFQTTPLVSVIVVAADSGPTLRECVRRVMECEVPLELILVDNGSSDGIPQAIERAMQ
QEWRLRPVYNHANLGFGPAVNRGAAQARGEVLLILNPDCMLDDASLRRLLELLKAHPKAG
VVGAVVCDEQGAPDRASYRRDPYLGRALRSLMGQGEGVNIGGEMPAGPVRAEAVSGALMA
MPRVVFENLRGFDEDYFLHCEDLDLCRRARDAGYEVWLAGDVHVLHGKGGSSRHRPVFVS
WHKHRGMWRWFRKFDPAARNPALSAVVWLGVWVHFLLKIPGQWLRLLRRKAAPVAGSA