Protein Info for ABZR86_RS19225 in Dyella japonica UNC79MFTsu3.2

Annotation: site-specific tyrosine recombinase XerD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 PF02899: Phage_int_SAM_1" amino acids 16 to 93 (78 residues), 44.2 bits, see alignment E=2e-15 TIGR02225: tyrosine recombinase XerD" amino acids 18 to 302 (285 residues), 346.5 bits, see alignment E=5.9e-108 PF00589: Phage_integrase" amino acids 117 to 289 (173 residues), 162.6 bits, see alignment E=8.2e-52

Best Hits

Swiss-Prot: 53% identical to XERD_VIBCH: Tyrosine recombinase XerD (xerD) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K04763, integrase/recombinase XerD (inferred from 58% identity to sml:Smlt0680)

Predicted SEED Role

"Tyrosine recombinase XerD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2IJJ3 at UniProt or InterPro

Protein Sequence (303 amino acids)

>ABZR86_RS19225 site-specific tyrosine recombinase XerD (Dyella japonica UNC79MFTsu3.2)
MSEKAASIAEADQRSIAAFLERVWSEDGLSDRTLEAYRRDLEGLARWLAGRGLGLSQARR
QHLSEYHGAQPVAVRSMARRQSSFRRYYGFVARNEPGFEDPTLLIERPRTPRSLPKALAE
REIESLLQAPDLETTLGLRDRAMLELMYASGLRVSELVELPLASLNLRQGVLRVTGKGGK
DRLVPVGELALERIEAYLATARPVLAKGRQPAALFLSKRGEGMTRQMFWTLVKRYALRVG
IVAKRISPHVLRHSFATHLLNHGADLRALQMLLGHSALSTTQIYTLVAKEGLKRLHAQHH
PRG