Protein Info for ABZR86_RS19110 in Dyella japonica UNC79MFTsu3.2

Annotation: LPS export ABC transporter permease LptF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 58 to 79 (22 residues), see Phobius details amino acids 100 to 122 (23 residues), see Phobius details amino acids 275 to 294 (20 residues), see Phobius details amino acids 306 to 329 (24 residues), see Phobius details amino acids 337 to 356 (20 residues), see Phobius details TIGR04407: LPS export ABC transporter permease LptF" amino acids 4 to 356 (353 residues), 294.2 bits, see alignment E=5e-92 PF03739: LptF_LptG" amino acids 7 to 356 (350 residues), 195.9 bits, see alignment E=5e-62

Best Hits

KEGG orthology group: K07091, lipopolysaccharide export system permease protein (inferred from 42% identity to xal:XALc_2672)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2IHJ9 at UniProt or InterPro

Protein Sequence (369 amino acids)

>ABZR86_RS19110 LPS export ABC transporter permease LptF (Dyella japonica UNC79MFTsu3.2)
MLSILDRYFLRELAQTVAAVATVLLVIMAGSAFARVLQQVANGSFPASVMFQVLGLNMLD
GLSNLLPLAGFLGVFWALGRMYRESEMHVLASSGMGPTGLLRPVGILALGLAVLSGIMSM
WLGPWAARTSDALVANANRSVIAAGLDAGRFTTLPGKGGIIFVDSLSRDGSVLGNTLMVT
ERPGKENGPPVLKLVTGKSGQLYQDTSGDGRYLSLHDGWQYELPLGADNWRKMSYARNDA
SLSNVQNDDSDEDPAHTLDTIALSRVTNADARAELAWRVTVPLMAVVLMMLSLPMSKQTP
REPRYGRMLLAVAAFFLYFNLLALCRGQIIKGHWHNAGPMWLVSLLVFAGAAWMFRNQYV
ARAPRKGKA