Protein Info for ABZR86_RS19060 in Dyella japonica UNC79MFTsu3.2

Annotation: L-serine ammonia-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00720: L-serine ammonia-lyase
  • amino acids 3 to 457 (455 residues), 725.2 bits, E=1.6e-222
• PF03315: SDH_beta
  • amino acids 4 to 158 (155 residues), 215.3 bits, E=5.6e-68
• PF03313: SDH_alpha
  • amino acids 189 to 454 (266 residues), 306.8 bits, E=1.5e-95

Best Hits

Swiss-Prot: 63% identical to SDHL_STRCO: L-serine dehydratase (sdaA) from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)

KEGG orthology group: K01752, L-serine dehydratase [EC: 4.3.1.17] (inferred from 78% identity to xca:xccb100_1302)

MetaCyc: 53% identical to L-serine deaminase I (Escherichia coli K-12 substr. MG1655)
L-serine ammonia-lyase. [EC: 4.3.1.17]

Predicted SEED Role

"L-serine dehydratase (EC 4.3.1.17)" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions (EC 4.3.1.17)

MetaCyc Pathways

• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• D-serine degradation (3/3 steps found)
• L-cysteine degradation II (3/3 steps found)
• L-serine degradation (3/3 steps found)
• glycine degradation (3/3 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• L-tryptophan degradation II (via pyruvate) (2/3 steps found)
• glycine betaine degradation I (5/8 steps found)
• glycine betaine degradation III (4/7 steps found)
• felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
• L-mimosine degradation (4/8 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• purine nucleobases degradation II (anaerobic) (9/24 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Glycine, serine and threonine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.1.17

Sequence Analysis Tools

See A0A1I2GD47 at UniProt or InterPro

Protein Sequence (460 amino acids)

>ABZR86_RS19060 L-serine ammonia-lyase (Dyella japonica UNC79MFTsu3.2)
MAVSVFDLFKIGIGPSSSHTVGPMRAAARFAERWLDEKGVLGRVARLRAELFGSLAMTGR
GHGTDKAVLLGFEGAHPDNVDPDRIPETLERIRHTKRLRVLGRHEIEFDEKRDLVFNKRQ
KLPFHTNGMRFTAYDAAGHELGTRDYYSVGGGFVVNQDEAAEDRIVADTTALPYPFSTGD
QLLALCEQHHLTIAQLMMENEKVWRSEAETRAGLLTIWKAMQDCVTRGLRSPGTLPGGLK
VTRRAPAMAQELRNQPEAALKDPLTILDWVNLYALAVNEENAAGGRVVTAPTNGAAGIVP
AVLHYYHRFCPKSNDDGVIEFLLTAAAIGILYKENASISGAEVGCQGEVGVACSMAAGGL
TAALGGNVLQVENAAEIGMEHNLGLTCDPIGGLVQIPCIERNAMGSVKAINASRMALKSD
GKHRVSLDKVIATMRDTGRDMKDKYKETSRGGLAVNVIEC