Protein Info for ABZR86_RS18985 in Dyella japonica UNC79MFTsu3.2

Annotation: protein-glutamate O-methyltransferase CheR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 PF03705: CheR_N" amino acids 17 to 66 (50 residues), 33.4 bits, see alignment 3e-12 PF01739: CheR" amino acids 83 to 264 (182 residues), 126.2 bits, see alignment E=1.1e-40

Best Hits

KEGG orthology group: K00575, chemotaxis protein methyltransferase CheR [EC: 2.1.1.80] (inferred from 54% identity to mag:amb3879)

Predicted SEED Role

"Chemotaxis protein methyltransferase CheR (EC 2.1.1.80)" in subsystem Bacterial Chemotaxis (EC 2.1.1.80)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.80

Use Curated BLAST to search for 2.1.1.80

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2GDD2 at UniProt or InterPro

Protein Sequence (287 amino acids)

>ABZR86_RS18985 protein-glutamate O-methyltransferase CheR (Dyella japonica UNC79MFTsu3.2)
MKEHSAGRTDGELEDIEVELFVRALQARHGYDFSQYAPASLKRRVQQLVHAHGTGTISAL
TGRLLHEADFLTTVLEGLSVPVSEMFRDPEVFSALREQVLPLLASYPQINIWQAGCAHGQ
EVYSLAILLEEAGLYERTQIYATDFNPAALRHAQEGIYPAREAQLWSRNYLAAGGSHTLA
DYYSARYELLKLDSRLRRNVIFANHNLVTDEVFCEAHLVLCRNVLIYFSDPLQDRTLGLF
RDSLVRGGFLCLGTRESLDFAPAAADFVPVDAGLRIYRLGAKAPRAG