Protein Info for ABZR86_RS18975 in Dyella japonica UNC79MFTsu3.2

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 PF00072: Response_reg" amino acids 8 to 120 (113 residues), 81.1 bits, see alignment E=6.6e-27 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 162 to 329 (168 residues), 140.2 bits, see alignment E=2.6e-45 PF00990: GGDEF" amino acids 165 to 326 (162 residues), 153 bits, see alignment E=6.1e-49

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2GEU6 at UniProt or InterPro

Protein Sequence (331 amino acids)

>ABZR86_RS18975 diguanylate cyclase (Dyella japonica UNC79MFTsu3.2)
MNIARPKILVVDDTHANLVAMRRLLANCGADLLEASSGNEALTLCLDHEFALILLDVNMP
DMDGYEVASLMGESGQLHETPIIFVTAAYADDIHRLKGYRFGAVDYIAKPVNDTILQSKV
RVFLELYEARAQLRATLSELSERNHQLGIEMAERERAEAAIRHQATHDMLTGLPNRVLFH
DRLRTAMQRAPRHGSAFALVLLDIDGFKGVNDQHGHPAGDDLLRAIAGRLNAALRASDTV
ARLGGDEFALVLEDVSDVDGLLHRCRELGGELAAPYPLEGRRGPFIAQVSASQGIALWAG
DARNDEDLIQAADRALYKAKEDGKNRCVMAP