Protein Info for ABZR86_RS18860 in Dyella japonica UNC79MFTsu3.2

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 transmembrane" amino acids 136 to 155 (20 residues), see Phobius details amino acids 175 to 199 (25 residues), see Phobius details amino acids 208 to 208 (1 residues), see Phobius details amino acids 210 to 230 (21 residues), see Phobius details amino acids 268 to 298 (31 residues), see Phobius details amino acids 318 to 338 (21 residues), see Phobius details amino acids 358 to 377 (20 residues), see Phobius details TIGR00056: ABC transport permease subunit" amino acids 130 to 376 (247 residues), 227.4 bits, see alignment E=1.2e-71 PF02405: MlaE" amino acids 165 to 374 (210 residues), 237.7 bits, see alignment E=5.2e-75

Best Hits

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 72% identity to pfs:PFLU0098)

Predicted SEED Role

"ABC-type transport system involved in resistance to organic solvents, permease component USSDB6A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2GA49 at UniProt or InterPro

Protein Sequence (381 amino acids)

>ABZR86_RS18860 ABC transporter permease (Dyella japonica UNC79MFTsu3.2)
MSPSTATGSAELDASSQPPQLRISGDWTLAHYADLERRVETLAAPLPQGTRIDLAALAAL
DTAGASLLVRLLGPDRIAELAQADGLPPARRALLDTVGKALDAYRIPAKARRRRSAVVEV
LARIGRAMDSVWRQQLQLLGFIGMTLEALARGILHPRRWRVTSLVAHVEQTGLDAVPIVA
LLTFMVGAVVAFLGSTVLADFGATIYTVDLIAFSFLREFGVLLTAILMAGRTASAFTAQI
GSMKANEEIDAIRALGLDPLELLVLPRVLALLVSLPMLTFLAMICGLLGGAVVCALTLDI
SPTMFLTLFKADIGVRHFLVGLSKAPVFAFLIAVIGCLEGFKVSGSAQSVGEHTTSSVVQ
SIFVVILLDAVAALFFMEMDW