Protein Info for ABZR86_RS18855 in Dyella japonica UNC79MFTsu3.2

Annotation: ATP-binding cassette domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 PF00005: ABC_tran" amino acids 32 to 180 (149 residues), 106.4 bits, see alignment E=1.9e-34

Best Hits

Swiss-Prot: 37% identical to MLAF_ECO57: Intermembrane phospholipid transport system ATP-binding protein MlaF (mlaF) from Escherichia coli O157:H7

KEGG orthology group: K02065, putative ABC transport system ATP-binding protein (inferred from 80% identity to pau:PA14_22670)

Predicted SEED Role

"ABC transporter ATP-binding protein USSDB6B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2GBL6 at UniProt or InterPro

Protein Sequence (270 amino acids)

>ABZR86_RS18855 ATP-binding cassette domain-containing protein (Dyella japonica UNC79MFTsu3.2)
MNAVAQEHSAQEDVIQVRDLVNRFGTQAVHEHLDLDVRRGEILGVVGGSGTGKSVLLRTI
VGLRRPTSGQVQVFGQDLLRLPPEQRSRIERRFGVLFQNGALFSSQNVVENIAMPLIEHA
GLKRPEAEALGTVKLALAGLPPGTEHKYPSELSGGMVKRAALARALALDPEVLFLDEPTA
GLDPISAAAFDQLILTLRDALGLTVFLVTHDLDTLYTICDRVAVLSQKKVLACDRLDVVA
QNEDPWVQSYFHGPRGRAALDAAEQTREVK