Protein Info for ABZR86_RS18780 in Dyella japonica UNC79MFTsu3.2

Annotation: D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 TIGR00213: D,D-heptose 1,7-bisphosphate phosphatase" amino acids 26 to 171 (146 residues), 181 bits, see alignment E=2.4e-57 TIGR01656: histidinol-phosphate phosphatase domain" amino acids 26 to 171 (146 residues), 121.2 bits, see alignment E=5.2e-39 TIGR01662: HAD hydrolase, family IIIA" amino acids 27 to 167 (141 residues), 94.2 bits, see alignment E=1.1e-30 PF13242: Hydrolase_like" amino acids 129 to 181 (53 residues), 28.3 bits, see alignment E=2.1e-10

Best Hits

KEGG orthology group: K03273, D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase [EC: 3.1.3.-] (inferred from 58% identity to reu:Reut_A0723)

Predicted SEED Role

"D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase (EC 3.1.1.-)" in subsystem Capsular heptose biosynthesis or LOS core oligosaccharide biosynthesis (EC 3.1.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.-, 3.1.3.-

Use Curated BLAST to search for 3.1.1.- or 3.1.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2G913 at UniProt or InterPro

Protein Sequence (209 amino acids)

>ABZR86_RS18780 D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase (Dyella japonica UNC79MFTsu3.2)
MSAPSAQGPRVFLDERAVLGAKTLRPALFLDRDGVINVDHGYVHRAEDTQWLPGIFELVR
RARAAGYLCIVVSNQAGLARGYYTDAQFRAYTAWMHAEFARHGAPLDATYYCPHHPEAGL
GDLKQACDCRKPQPGMFLAARDALGVDLPVSIMVGNQATDMQAALAAAVGRCYWLDGERD
RAAEWGGKVIVAAGLDDIMPAGEIAAQPG