Protein Info for ABZR86_RS18770 in Dyella japonica UNC79MFTsu3.2

Annotation: SIS domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 PF13580: SIS_2" amino acids 27 to 150 (124 residues), 98.2 bits, see alignment E=4.3e-32 PF01380: SIS" amino acids 109 to 172 (64 residues), 34.5 bits, see alignment E=1.7e-12

Best Hits

Swiss-Prot: 58% identical to GMHA_ANETH: Phosphoheptose isomerase (gmhA) from Aneurinibacillus thermoaerophilus

KEGG orthology group: K03271, phosphoheptose isomerase [EC: 5.-.-.-] (inferred from 58% identity to hmr:Hipma_1692)

MetaCyc: 58% identical to D-sedoheptulose 7-phosphate isomerase (Aneurinibacillus thermoaerophilus)
RXN0-4301 [EC: 5.3.1.28]

Predicted SEED Role

"Phosphoheptose isomerase 1 (EC 5.3.1.-)" in subsystem Capsular heptose biosynthesis or LOS core oligosaccharide biosynthesis (EC 5.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.-.-.-, 5.3.1.-

Use Curated BLAST to search for 5.-.-.- or 5.3.1.- or 5.3.1.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2G8W2 at UniProt or InterPro

Protein Sequence (204 amino acids)

>ABZR86_RS18770 SIS domain-containing protein (Dyella japonica UNC79MFTsu3.2)
MAHHVKAMLQSEFSKSIALLQTMSGDEALHGQVQQVLELSVQALKSGNKLLFAGNGGSAA
DAQHWAGELVSRFYFDRPGLPAIALTTDTSILTAIGNDYGYDYVFARQVEALGQAGDVLF
AISTSGNSKNIVRAIDAARTKGLKVVGFTGQGGGAMAVLCDVCFRVPSPETPRIQEGHEA
LGHLICALIEQEIFGQEKTGDAGH