Protein Info for ABZR86_RS18735 in Dyella japonica UNC79MFTsu3.2

Annotation: dTDP-glucose 4,6-dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 transmembrane" amino acids 12 to 28 (17 residues), see Phobius details TIGR01181: dTDP-glucose 4,6-dehydratase" amino acids 11 to 343 (333 residues), 508.6 bits, see alignment E=3.1e-157 PF02719: Polysacc_synt_2" amino acids 11 to 120 (110 residues), 36.1 bits, see alignment E=1.5e-12 PF04321: RmlD_sub_bind" amino acids 11 to 181 (171 residues), 50.9 bits, see alignment E=4.2e-17 PF16363: GDP_Man_Dehyd" amino acids 12 to 330 (319 residues), 320.7 bits, see alignment E=5e-99 PF01073: 3Beta_HSD" amino acids 12 to 239 (228 residues), 37 bits, see alignment E=7.1e-13 PF01370: Epimerase" amino acids 12 to 257 (246 residues), 231.2 bits, see alignment E=4.3e-72 PF07993: NAD_binding_4" amino acids 80 to 193 (114 residues), 25.1 bits, see alignment E=3.3e-09

Best Hits

Swiss-Prot: 75% identical to RMLB_XANCB: dTDP-glucose 4,6-dehydratase (rfbB) from Xanthomonas campestris pv. campestris (strain B100)

KEGG orthology group: K01710, dTDP-glucose 4,6-dehydratase [EC: 4.2.1.46] (inferred from 79% identity to psu:Psesu_2450)

MetaCyc: 58% identical to dTDP-glucose 4,6-dehydratase 1 (Escherichia coli K-12 substr. MG1655)
dTDP-glucose 4,6-dehydratase. [EC: 4.2.1.46]

Predicted SEED Role

"dTDP-glucose 4,6-dehydratase (EC 4.2.1.46)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 4.2.1.46)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.46

Use Curated BLAST to search for 4.2.1.46

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2G8F7 at UniProt or InterPro

Protein Sequence (356 amino acids)

>ABZR86_RS18735 dTDP-glucose 4,6-dehydratase (Dyella japonica UNC79MFTsu3.2)
MSSPLPGSSPLLVTGGAGFIGANFVLRAIAEGRKVVNLDKLTYAGNLDTLASLQDNPLHV
FVQGDIGDRELIARLLATHRPSAIVNFAAESHVDRSIDGPAAFVETNVVGTLALLEAARD
YWKSLEGGAAQSFRFLHVSTDEVYGSLGSEGKFTEQTPYAPNSPYSASKAASDHLVRAFH
HTYGLPVLTTNCSNNYGPYQFPEKLIPLVIQKALAGEPLPVYGDGMNIRDWLFVGDHCSA
IARVLEAGQVGETYNVGGNAERENLTVVKAICALLDERHPLADGRRREALITFVKDRPGH
DRRYAIDASKLQRELGWTPSQTFESGIAQTVHWYLDNQAWVERVLDGSYRMERLGQ