Protein Info for ABZR86_RS18730 in Dyella japonica UNC79MFTsu3.2

Annotation: glucose-1-phosphate thymidylyltransferase RfbA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 37 to 55 (19 residues), see Phobius details TIGR01207: glucose-1-phosphate thymidylyltransferase" amino acids 5 to 289 (285 residues), 516.7 bits, see alignment E=7e-160 PF00483: NTP_transferase" amino acids 5 to 241 (237 residues), 265.1 bits, see alignment E=6.5e-83 PF12804: NTP_transf_3" amino acids 6 to 136 (131 residues), 40.2 bits, see alignment E=3.9e-14

Best Hits

Swiss-Prot: 74% identical to RMLA_XANCB: Glucose-1-phosphate thymidylyltransferase (rmlA) from Xanthomonas campestris pv. campestris (strain B100)

KEGG orthology group: K00973, glucose-1-phosphate thymidylyltransferase [EC: 2.7.7.24] (inferred from 76% identity to psu:Psesu_2449)

MetaCyc: 69% identical to glucose-1-phosphate thymidylyltransferase 1 (Escherichia coli K-12 substr. MG1655)
Glucose-1-phosphate thymidylyltransferase. [EC: 2.7.7.24]

Predicted SEED Role

"Glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 2.7.7.24)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.24

Use Curated BLAST to search for 2.7.7.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2G9Y5 at UniProt or InterPro

Protein Sequence (295 amino acids)

>ABZR86_RS18730 glucose-1-phosphate thymidylyltransferase RfbA (Dyella japonica UNC79MFTsu3.2)
MSTRKGIILAGGSGTRLYPITQAVSKQLLPVYDKPMIYYPLATLMLAGVREILVINTPHE
QPLFERLLGDGSQWGIDIRYAVQPSPDGLAQAFLIGREFIGNDPSCLVLGDNIFYGVGLT
ERLKRASSREHGATVFGYWVRDPERYGVAEFDSSGRVIGLEEKPAQPKSSYAVTGLYFYD
NRVCDYAASLKPSARGELEITDLNRVYLQDNSLHLEQLGRGFAWLDTGTHESLMEAGNYI
ETIENRQGLKVCCPEEIAFINGWIDAEQVLRAAAPLAKTGYGQYLQRLVTQGHIR