Protein Info for ABZR86_RS18720 in Dyella japonica UNC79MFTsu3.2

Annotation: dTDP-4-dehydrorhamnose reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 PF04321: RmlD_sub_bind" amino acids 1 to 306 (306 residues), 322.6 bits, see alignment E=3e-100 TIGR01214: dTDP-4-dehydrorhamnose reductase" amino acids 2 to 305 (304 residues), 315.1 bits, see alignment E=1.8e-98 PF01370: Epimerase" amino acids 3 to 175 (173 residues), 56.4 bits, see alignment E=4.6e-19 PF16363: GDP_Man_Dehyd" amino acids 46 to 149 (104 residues), 29.4 bits, see alignment E=9e-11

Best Hits

KEGG orthology group: K00067, dTDP-4-dehydrorhamnose reductase [EC: 1.1.1.133] (inferred from 56% identity to xac:XAC3582)

Predicted SEED Role

"dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 1.1.1.133)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.133

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2GAY5 at UniProt or InterPro

Protein Sequence (314 amino acids)

>ABZR86_RS18720 dTDP-4-dehydrorhamnose reductase (Dyella japonica UNC79MFTsu3.2)
MKILLLGGNGQLGQTLAGHAGLGALGSLVVATRDGKLAGGGSGEVADLSDLAGLKALLDQ
VEPDLVINAAAYTAVDRAETEEALATRINGEAPGVMGAWAQAHDALVLHYSTDYVFDGES
ATPYRPGDATAPIGAYGRSKLAGEQALQQSGAAHLILRTAWVYAPVGHNFLRTMLRLGAE
RDELRVVADQHGAPTTTSLIADGSVAALSQWLEADAATRPGLQGIHHLVAGGSTTWHGFA
SAIMARAHALGLLEKQPKVSPIGTADFPTPARRPHYSVLDNRGFEQTFHIHLPSWQAGLD
DVLEALAAKGTQTC