Protein Info for ABZR86_RS18675 in Dyella japonica UNC79MFTsu3.2

Annotation: phosphoglycerate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00162: PGK
  • amino acids 1 to 373 (373 residues), 477.6 bits, E=1.4e-147

Best Hits

Swiss-Prot: 76% identical to PGK_STRMK: Phosphoglycerate kinase (pgk) from Stenotrophomonas maltophilia (strain K279a)

KEGG orthology group: K00927, phosphoglycerate kinase [EC: 2.7.2.3] (inferred from 78% identity to psu:Psesu_0728)

MetaCyc: 66% identical to phosphoglycerate kinase (Escherichia coli K-12 substr. MG1655)
Phosphoglycerate kinase. [EC: 2.7.2.3]

Predicted SEED Role

"Phosphoglycerate kinase (EC 2.7.2.3)" in subsystem Calvin-Benson cycle or Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 2.7.2.3)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (23/26 steps found)
• superpathway of glucose and xylose degradation (16/17 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (16/17 steps found)
• superpathway of anaerobic sucrose degradation (17/19 steps found)
• Bifidobacterium shunt (14/15 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (19/22 steps found)
• glycolysis II (from fructose 6-phosphate) (11/11 steps found)
• glycolysis III (from glucose) (11/11 steps found)
• glycolysis I (from glucose 6-phosphate) (12/13 steps found)
• Entner-Doudoroff pathway I (9/9 steps found)
• homolactic fermentation (11/12 steps found)
• gluconeogenesis I (11/13 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• gluconeogenesis III (10/12 steps found)
• heterolactic fermentation (14/18 steps found)
• glycolysis IV (8/10 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• glycolysis VI (from fructose) (8/11 steps found)
• superpathway of hexitol degradation (bacteria) (13/18 steps found)
• Calvin-Benson-Bassham cycle (9/13 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (13/19 steps found)
• superpathway of N-acetylneuraminate degradation (15/22 steps found)
• ethene biosynthesis V (engineered) (17/25 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (17/26 steps found)
• oxygenic photosynthesis (10/17 steps found)
• glycerol degradation to butanol (9/16 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carbon fixation in photosynthetic organisms
• Glycolysis / Gluconeogenesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.3

Sequence Analysis Tools

See A0A1I2G833 at UniProt or InterPro

Protein Sequence (387 amino acids)

>ABZR86_RS18675 phosphoglycerate kinase (Dyella japonica UNC79MFTsu3.2)
MSDLDLRGKRVLIREDLNVPIEDGRITSTQRLDASLPTIKAARDAGARVMVISHLGRPKE
GQFDAESSLAPVAKWLGDKLGTPVRLIADYLGGVDVAEGEVVVLENCRMNVGEGKDDEAL
SKKYAALCDIFVMDAFGTAHRAQASTHGVIKYAPVAAAGPLLSAELDALGKALEHPAHPL
LAIVAGSKVSTKLTLLENLIGKVDQLIVGGGIANTFIAAAGYGVGNSLYEPDLLDAAKKV
IADAKRRGAEVPMPVDVVVAPEFSAHAPATVKPVDQVKDGEMILDIGPQTAKNYAALIAK
AGTVVWNGPVGVFEFDAFGKGTETLARAVASSDAFSIAGGGDTLAAVEKYGIEKDVSYIS
TGGGAFLEFLEGKELPAVAALKARAAK