Protein Info for ABZR86_RS18660 in Dyella japonica UNC79MFTsu3.2

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF20434: BD-FAE" amino acids 86 to 192 (107 residues), 59.3 bits, see alignment E=6.1e-20 PF07859: Abhydrolase_3" amino acids 100 to 308 (209 residues), 245.4 bits, see alignment E=7.8e-77 PF00326: Peptidase_S9" amino acids 152 to 305 (154 residues), 24.5 bits, see alignment E=2.6e-09

Best Hits

Swiss-Prot: 40% identical to YR526_MIMIV: Putative alpha/beta hydrolase R526 (MIMI_R526) from Acanthamoeba polyphaga mimivirus

KEGG orthology group: K01066, esterase / lipase [EC: 3.1.1.-] (inferred from 61% identity to ret:RHE_CH03106)

Predicted SEED Role

"Lipase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.-

Use Curated BLAST to search for 3.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2G8X1 at UniProt or InterPro

Protein Sequence (338 amino acids)

>ABZR86_RS18660 alpha/beta hydrolase (Dyella japonica UNC79MFTsu3.2)
MNTFKTLFAAIALGAAAQASAGQLEPSTQAFVDALAAKGGQPIYKLPVAQARQVLEDAQS
GNVAKLAVDKQEISFDDAKAGKVSLTIIRPRGVDGTLPAVLYIHGAGWVLGSENTHDRLV
RQLAHGARAAVVFVNYARAPEAKFPVQDEQAYAAARWVVEHGKQHGIDGNNMAIAGDSVG
GNMTAAVTLMAKQRGGPKFVYQVLFYPVTDANFDNGSYREFANGPWLTLPAMQWFWNAYV
PNEAARKNPLVTPLNATLEQLKGLPPALVITDDNDVLRDEGEAYAHKLMDAGVEVTATRY
LGTIHDFVMLNALGDTPAARAAVEQAGGKLRAALYPAR