Protein Info for ABZR86_RS18615 in Dyella japonica UNC79MFTsu3.2

Annotation: type I glyceraldehyde-3-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00044: Gp_dh_N
  • amino acids 3 to 106 (104 residues), 134.7 bits, E=1.3e-43
• TIGR01534: glyceraldehyde-3-phosphate dehydrogenase, type I
  • amino acids 4 to 328 (325 residues), 423.8 bits, E=2.4e-131
• PF02800: Gp_dh_C
  • amino acids 160 to 316 (157 residues), 214.9 bits, E=4.6e-68

Best Hits

Swiss-Prot: 74% identical to G3PP_CUPNH: Glyceraldehyde-3-phosphate dehydrogenase, plasmid (cbbGP) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K00134, glyceraldehyde 3-phosphate dehydrogenase [EC: 1.2.1.12] (inferred from 78% identity to mpt:Mpe_A0260)

MetaCyc: 54% identical to Gap (Thermotoga maritima)
Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). [EC: 1.2.1.12]

Predicted SEED Role

"NAD-dependent glyceraldehyde-3-phosphate dehydrogenase (EC 1.2.1.12)" in subsystem Calvin-Benson cycle or Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Pyridoxin (Vitamin B6) Biosynthesis or Redox-dependent regulation of nucleus processes (EC 1.2.1.12)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (23/26 steps found)
• superpathway of glucose and xylose degradation (16/17 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (16/17 steps found)
• superpathway of anaerobic sucrose degradation (17/19 steps found)
• Bifidobacterium shunt (14/15 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (19/22 steps found)
• glycolysis II (from fructose 6-phosphate) (11/11 steps found)
• glycolysis III (from glucose) (11/11 steps found)
• glycolysis I (from glucose 6-phosphate) (12/13 steps found)
• Entner-Doudoroff pathway I (9/9 steps found)
• homolactic fermentation (11/12 steps found)
• gluconeogenesis I (11/13 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• gluconeogenesis III (10/12 steps found)
• heterolactic fermentation (14/18 steps found)
• pyridoxal 5'-phosphate biosynthesis I (6/7 steps found)
• glycolysis IV (8/10 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• glycolysis VI (from fructose) (8/11 steps found)
• superpathway of hexitol degradation (bacteria) (13/18 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (8/12 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (13/19 steps found)
• superpathway of N-acetylneuraminate degradation (15/22 steps found)
• glycerol degradation to butanol (9/16 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Glycolysis / Gluconeogenesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.12

Sequence Analysis Tools

See A0A1I2G7B2 at UniProt or InterPro

Protein Sequence (337 amino acids)

>ABZR86_RS18615 type I glyceraldehyde-3-phosphate dehydrogenase (Dyella japonica UNC79MFTsu3.2)
MAIKVAINGYGRIGRNVLRALYESGRTDEFQIVAVNDLGDAETNAHLTQYDTAHGRFPGT
VTVDGGDLIVNGDRVKVCAERDPSKLPWGELGVDVVLECTGLFTSKAKAGAHITAGAKKV
IISAPGEKDVDGTFVFGVNDDTLTAAHQVISNASCTTNCLAPLAKVLHEKIGIVHGLMTT
IHAYTNDQVLTDVYHKDLRRARSATMSQIPTKTGAAAAVGLVLPELNGKLDGFAMRVPTI
NVSVVDLSFVAKRATSHEEIDAIVNEAANGKLKGILAVNTKPLVSVDFNHNPASSTYDST
QTRVMEGTLVKVLSWYDNEWGFSNRMLDMTKALMAAK