Protein Info for ABZR86_RS18595 in Dyella japonica UNC79MFTsu3.2

Annotation: capsule biosynthesis GfcC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF20616: Caps_syn_GfcC_N" amino acids 21 to 143 (123 residues), 36.6 bits, see alignment E=5.3e-13 PF06251: Caps_syn_GfcC_C" amino acids 173 to 247 (75 residues), 40.1 bits, see alignment E=3e-14

Best Hits

KEGG orthology group: None (inferred from 43% identity to pfs:PFLU3660)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2G8M8 at UniProt or InterPro

Protein Sequence (258 amino acids)

>ABZR86_RS18595 capsule biosynthesis GfcC family protein (Dyella japonica UNC79MFTsu3.2)
MRVARLLGWLVCLAWPIHAMAVSVSVSGQVERPGMQSLQGNARLADAAAAAQVKFESYVL
GASWTQRSRQLEQKRLQAGLLYELGAVADQATRDGNAPLAALSVQLRQWLQSMPVTGRHV
ARTLDPGALAANDADNLPLEDGDTLSYPRRPSTVRVVGAVQKPCELSHVALQDAREYVRA
CATQMADRDVLYVIQPDGQVSELGIALWNESPPMVLAPGAIVYVPLDRRLVAGAADSVFN
RELADFIATQPLDGGVAP