Protein Info for ABZR86_RS18585 in Dyella japonica UNC79MFTsu3.2

Annotation: polysaccharide biosynthesis/export family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 PF02563: Poly_export" amino acids 47 to 131 (85 residues), 84.6 bits, see alignment E=6.6e-28 PF10531: SLBB" amino acids 222 to 270 (49 residues), 34.2 bits, see alignment 2.8e-12

Best Hits

Swiss-Prot: 40% identical to WZA_ECO57: Putative polysaccharide export protein wza (wza) from Escherichia coli O157:H7

KEGG orthology group: K01991, polysaccharide export outer membrane protein (inferred from 52% identity to pfo:Pfl01_3833)

MetaCyc: 40% identical to outer membrane polysaccharide export protein Wza (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Polysaccharide export lipoprotein Wza" in subsystem Colanic acid biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2G8H9 at UniProt or InterPro

Protein Sequence (340 amino acids)

>ABZR86_RS18585 polysaccharide biosynthesis/export family protein (Dyella japonica UNC79MFTsu3.2)
MSATDFSRQGSIDAARYQLVPITPKLLAMDKASNPLATLPDELRSYQPEPYRIGIGDSLY
ITVWDHPELTSPAGSQQLPSANGRVVRADGTLFYPYIGVLKASGKTVEELRTEISHRLAK
YVQDPQVDMSVISYGAQRITMRGAFVKTDPLPVTVTPVSLAQAIGTAQVNTDQADLSGLV
LSRDGHDYHLDLDALTRNHQLADIWLKPGDQIFLPYGDRKEVYVVGEVQRPAAFPFKTSD
MSLTQALGKAGGLNETTSKGNAVYVIRGVEDMEKSPATIYQLDAKSPAAFAMASQFSVHP
GDVVFVGPAGVTRWNRFLSQLLPLSGIVTNAASAKNDLTN