Protein Info for ABZR86_RS18560 in Dyella japonica UNC79MFTsu3.2

Annotation: glycosyltransferase family 4 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 PF13477: Glyco_trans_4_2" amino acids 2 to 138 (137 residues), 62.5 bits, see alignment E=1.8e-20 PF13579: Glyco_trans_4_4" amino acids 18 to 173 (156 residues), 56.4 bits, see alignment E=1.6e-18 PF13439: Glyco_transf_4" amino acids 19 to 157 (139 residues), 35.9 bits, see alignment E=2.8e-12 PF20706: GT4-conflict" amino acids 189 to 343 (155 residues), 29.2 bits, see alignment E=1.7e-10 PF00534: Glycos_transf_1" amino acids 191 to 348 (158 residues), 96.8 bits, see alignment E=3.7e-31 PF13692: Glyco_trans_1_4" amino acids 196 to 337 (142 residues), 91.6 bits, see alignment E=2e-29 PF13524: Glyco_trans_1_2" amino acids 278 to 358 (81 residues), 45.2 bits, see alignment E=3.1e-15

Best Hits

KEGG orthology group: None (inferred from 66% identity to bpy:Bphyt_4709)

Predicted SEED Role

"Lipid carrier : UDP-N-acetylgalactosaminyltransferase (EC 2.4.1.-) / Alpha-1,3-N-acetylgalactosamine transferase PglA (EC 2.4.1.-); Putative glycosyltransferase" in subsystem N-linked Glycosylation in Bacteria (EC 2.4.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2G8B1 at UniProt or InterPro

Protein Sequence (390 amino acids)

>ABZR86_RS18560 glycosyltransferase family 4 protein (Dyella japonica UNC79MFTsu3.2)
MKIVLFANTDWYLYNFRRSLALALHKAGHELLLLSPPGPYGEKLRALGLRWEPVPMERRS
LNPLRELALLRYLTRLLKRERPALVHGFTIKCAVYGSLAARLAGVPARVNAVAGMGYVFT
SNDLKARALRPVVRALLRLALDGEGARLILQNSDDVALFERAGLVDPGRIRLVRGSGVDC
WRFVKRTGERSGGPLRVLVAARLLWDKGLEEYVAAARELLAEGRRIEFLLAGTPDPGNPA
AVPEDTVRGWVNEGVVNWLGHVEDMPTLLGAVDVVALPSYREGLPKTLIEAAACAQPLIT
TDVPGCREVVTDDVDGLLVPVRDGKALAHAIRRLHDDPALARRLGEAAWAKAHAEFDERI
VIRRTVDVYRELCGPLEMPAEQVARERRVA