Protein Info for ABZR86_RS18545 in Dyella japonica UNC79MFTsu3.2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 transmembrane" amino acids 28 to 45 (18 residues), see Phobius details amino acids 51 to 70 (20 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 136 to 156 (21 residues), see Phobius details amino acids 176 to 198 (23 residues), see Phobius details amino acids 208 to 225 (18 residues), see Phobius details amino acids 230 to 249 (20 residues), see Phobius details amino acids 261 to 282 (22 residues), see Phobius details amino acids 347 to 372 (26 residues), see Phobius details amino acids 388 to 406 (19 residues), see Phobius details amino acids 412 to 430 (19 residues), see Phobius details

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2G843 at UniProt or InterPro

Protein Sequence (435 amino acids)

>ABZR86_RS18545 hypothetical protein (Dyella japonica UNC79MFTsu3.2)
MNPSANPSMHGVPGPVPMSERSITRRHLFLLAAIGLLFLAVVIPNSLPVPTAAMLGVTAV
LALPGFRFGLGFKKLLALYMCTAMVTVIYTAIGYLNDAPPEAAAQMLVIYILSPLLWMLV
AAGLMRAPGPQRLVDWFAVLTVFACASVALYFYLYFRYGADAVSFFFKGQANINLQGGFA
GAIMHVYGSLIFLAGGFFSSPELIRSRLLRMAVLAMIFVCAVTSGRSALILAIPVGWVLG
RLLASRTVGFQRSLRSPLTRLVKVGLPMAVGMVAVVILLQTYTSVRLDVIYDSFADKLSS
GGGSSRVGMAGSLFQGILDNGGIGAGHGKGVSFVSSAEYPWRYELVWLATIYRVGLLGAA
VYAFPFLVYILRVLRLAAARQLPPHHKFLFSAFVAAFIASNTNPYIEAFAFQWMYTIPLV
ALFVEFPSGVERVPA