Protein Info for ABZR86_RS18495 in Dyella japonica UNC79MFTsu3.2

Annotation: polysaccharide biosynthesis tyrosine autokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 733 transmembrane" amino acids 29 to 49 (21 residues), see Phobius details amino acids 444 to 464 (21 residues), see Phobius details PF02706: Wzz" amino acids 13 to 105 (93 residues), 74.5 bits, see alignment E=1.8e-24 PF13807: GNVR" amino acids 384 to 466 (83 residues), 101.7 bits, see alignment E=4.3e-33 TIGR01007: capsular exopolysaccharide family" amino acids 523 to 727 (205 residues), 178.6 bits, see alignment E=5.7e-57 PF01656: CbiA" amino acids 545 to 717 (173 residues), 31.3 bits, see alignment E=4.5e-11 PF09140: MipZ" amino acids 553 to 660 (108 residues), 26.1 bits, see alignment E=1.3e-09 PF13614: AAA_31" amino acids 553 to 669 (117 residues), 40.9 bits, see alignment E=5.5e-14

Best Hits

KEGG orthology group: K00903, protein-tyrosine kinase [EC: 2.7.10.-] (inferred from 52% identity to pfo:Pfl01_3844)

Predicted SEED Role

"Tyrosine-protein kinase Wzc (EC 2.7.10.2)" in subsystem Colanic acid biosynthesis (EC 2.7.10.2)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.10.- or 2.7.10.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2K5D1 at UniProt or InterPro

Protein Sequence (733 amino acids)

>ABZR86_RS18495 polysaccharide biosynthesis tyrosine autokinase (Dyella japonica UNC79MFTsu3.2)
MTDPRAVTQRNDEELDLGAILGTLVDNKWLIFAITGLFLACSLAYALLATPIYQADAMVQ
VEQKVPELPGISALSQTLGASNSQANTEIALITSRAVIGKAVDDLKLDINVSARHFPMIG
TGIARRFANANPGVLAAPWLGFNRYDWGGSKLDLQRIEVPDDLLGKVMTLVAGENGGYTL
LNPEGDELLQGAVGQIATGHGVTLQVGSLKANPGTRFDVRRERALTTINQLQQAIQATEK
GKDSGIIGLSYQNASPKLAVALLDRVSEWYVRQNVEWNAAEAANSLKFVQEQLPKVRQDL
DRAQAALNAFQIQAKSVDITMQTKALLDQSVAVEANIQQLRMQQADVARRFTPQHPAYRA
LMQQIGQLEQQKGDMEKQVGALPDTQQELLKLTRDVDVSNQTYTGLLNQAQQLDIARAGK
VGNVHIVDNAQVDVTSPVKPKKAMVVFGGTFVGAFLAFGLVFVRQMLNRGVEEPSVIEQL
GLPVYASVPVSPTEHEIALSDRARSDGRHHLLAISSPADLATEALRSLRTSLHFARMEAK
NNILMISGSSPEAGKTFVSANLAAVMAQAGQRVLVIDGDMRKGTLHKVMGGRPNNGLSEL
ISGQIDMETAIRPIASLENLHYIARGKIPPNPSELLMNQRFAEVMDQLMPRYDLVLIDTP
PILAVTDASIIGHMAGTCLLVVRFGLNQAREIALARQRFAQNGVEIKGAIFNAVERRSSG
YYSYGYYEYKNGT