Protein Info for ABZR86_RS18490 in Dyella japonica UNC79MFTsu3.2

Annotation: low molecular weight protein-tyrosine-phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01451: LMWPc
  • amino acids 5 to 141 (137 residues), 137.4 bits, E=2.3e-44

Best Hits

Swiss-Prot: 49% identical to ETP_ECO57: Low molecular weight protein-tyrosine-phosphatase Etp (etp) from Escherichia coli O157:H7

KEGG orthology group: K01104, protein-tyrosine phosphatase [EC: 3.1.3.48] (inferred from 57% identity to psu:Psesu_2991)

MetaCyc: 49% identical to phosphotyrosine-protein phosphatase Etp (Escherichia coli K-12 substr. MG1655)
Protein-tyrosine-phosphatase. [EC: 3.1.3.48]

Predicted SEED Role

"Low molecular weight protein-tyrosine-phosphatase Wzb (EC 3.1.3.48)" in subsystem Colanic acid biosynthesis (EC 3.1.3.48)

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.48

Use Curated BLAST to search for 3.1.3.48

Sequence Analysis Tools

See A0A1I2K3A8 at UniProt or InterPro

Protein Sequence (154 amino acids)

>ABZR86_RS18490 low molecular weight protein-tyrosine-phosphatase (Dyella japonica UNC79MFTsu3.2)
MFQRILLVCVGNICRSPTAEYLLRDRLRDTSAQISSAGLGALEDHPMDATAAALLHEHGI
DAQAHRGRQLQPSMLRDMDLVLVMEKSHAARIARLAPESSGKVLLLGKWLGEKEIPDPYG
QSRPAFEHVYGLIDQAIARWLPYLTPSLSKAASS