Protein Info for ABZR86_RS18465 in Dyella japonica UNC79MFTsu3.2

Annotation: MarR family winged helix-turn-helix transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 PF01978: TrmB" amino acids 44 to 96 (53 residues), 26.5 bits, see alignment E=1.2e-09 PF12802: MarR_2" amino acids 46 to 104 (59 residues), 54.2 bits, see alignment E=3.3e-18 PF01047: MarR" amino acids 47 to 104 (58 residues), 36.2 bits, see alignment E=1.1e-12 PF13463: HTH_27" amino acids 50 to 113 (64 residues), 25 bits, see alignment E=4.8e-09

Best Hits

KEGG orthology group: None (inferred from 66% identity to psu:Psesu_2517)

Predicted SEED Role

"Transcriptional regulator, MarR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2JNH5 at UniProt or InterPro

Protein Sequence (171 amino acids)

>ABZR86_RS18465 MarR family winged helix-turn-helix transcriptional regulator (Dyella japonica UNC79MFTsu3.2)
MPAEPQDAHRPDHAPLELERFLPYRLSILSNTVSQAIADDYQARFDLSVTEWRVMAVLAR
FEGLSAREVAERTAMDKVAVSRALARLVEAGRVNRGTHEGDKRRSVLSLSEAGWEVHDVV
APMARAREREVLAKLDADEQAWLSRILDKLLGPPVPPRSGQPQSGAEATVA