Protein Info for ABZR86_RS18450 in Dyella japonica UNC79MFTsu3.2

Annotation: pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 TIGR03181: pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha subunit" amino acids 11 to 351 (341 residues), 425.1 bits, see alignment E=8.7e-132 PF00676: E1_dh" amino acids 40 to 325 (286 residues), 252.2 bits, see alignment E=5.5e-79 PF13292: DXP_synthase_N" amino acids 127 to 200 (74 residues), 27.6 bits, see alignment E=1.8e-10

Best Hits

KEGG orthology group: K00161, pyruvate dehydrogenase E1 component subunit alpha [EC: 1.2.4.1] (inferred from 64% identity to sml:Smlt4338)

Predicted SEED Role

"Branched-chain alpha-keto acid dehydrogenase, E1 component, alpha subunit (EC 1.2.4.4)" in subsystem Isoleucine degradation or Leucine Degradation and HMG-CoA Metabolism or Valine degradation (EC 1.2.4.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.4.1, 1.2.4.4

Use Curated BLAST to search for 1.2.4.1 or 1.2.4.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2JL91 at UniProt or InterPro

Protein Sequence (361 amino acids)

>ABZR86_RS18450 pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha (Dyella japonica UNC79MFTsu3.2)
MSIAAKFEIEYLQYLDAEGNQVRDDLPAFAKDLDHMVELYKLMMSTRVFDAKSVALQRTG
KLGTYASCLGHEAAHVGIGSAMKPEDVFAPSYREYGAQLYRGVQPREVYMYWGGDERGND
YQKEPARHDFAWSVPIATQCLHAAGSALAFKIRNEKRVAVCTIGDGGSSKGDFYGAINIT
GAQNLPMVAVIVNNQWAISVPRKIQSGAPTLAQKGIAAGLFSIQVDGNDIIAVRKAMEDA
LDRARNGQGGSVLELVTYRLSDHTTADDARRYRGEQEVKDAWAKEPMKRLRAWLVAKNVW
DDAKEEAWKAECDEWMDNEVNAYLETKTQPVTAMFDYTFAEVPADLAKQRDLALSLDKKA
H