Protein Info for ABZR86_RS18290 in Dyella japonica UNC79MFTsu3.2

Annotation: AdeC/AdeK/OprM family multidrug efflux complex outer membrane factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 13 to 472 (460 residues), 430.6 bits, see alignment E=3.7e-133 PF02321: OEP" amino acids 67 to 257 (191 residues), 81.4 bits, see alignment E=3.8e-27 amino acids 291 to 470 (180 residues), 117.5 bits, see alignment E=3.1e-38

Best Hits

Swiss-Prot: 56% identical to TTGC_PSEPK: Probable efflux pump outer membrane protein TtgC (ttgC) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 74% identity to xac:XAC2842)

Predicted SEED Role

"RND efflux system, outer membrane lipoprotein CmeC" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2JMU1 at UniProt or InterPro

Protein Sequence (497 amino acids)

>ABZR86_RS18290 AdeC/AdeK/OprM family multidrug efflux complex outer membrane factor (Dyella japonica UNC79MFTsu3.2)
MTPIRTTVIAFAVACLVSGCNLAPHYVRPGSPVPEAFAEGEGTSAPAAAATPVADLGWRE
VFTDPALQEVIALALDNNRDLRVAALNIEVARAQYRVQRADLSPSLSVNGSGNSSRTPGD
LSATGRPQVTRDYSATLGFSAYELDLFGRVRNLKEQALQQFLSTAEARRSTHISLVAQVV
TAYYTLAADQELLKLAQSTLASQEYSYRLQQRSFDYGVASELTISQARTTVESARSDVER
YTAQVAQDHNALTLLVGAAVPARLLPDALPATADAERNVLAAVPAGLSSDLLQRRPDILE
AERNLRAANANIGAARAAFYPGISLTASAGSASASLSGLFDAGSGSWSFAPSISIPIFNA
GRNRANLDMAKANRDIDVARYEKAIQTAFREVADALAQRGTLGRQLQAQQALVDASADSY
RLSQARFDRGVDSYLGVLDAQRSLYSAQQSLIGTRLDRLTNLVTFYKAMGGGWVSSTADA
TGHSSSHDQMKTASIKD