Protein Info for ABZR86_RS18250 in Dyella japonica UNC79MFTsu3.2

Annotation: TetR/AcrR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 transmembrane" amino acids 161 to 178 (18 residues), see Phobius details PF00440: TetR_N" amino acids 40 to 70 (31 residues), 24.4 bits, see alignment 9.9e-10

Best Hits

KEGG orthology group: None (inferred from 53% identity to bja:blr7058)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2J5R9 at UniProt or InterPro

Protein Sequence (203 amino acids)

>ABZR86_RS18250 TetR/AcrR family transcriptional regulator (Dyella japonica UNC79MFTsu3.2)
MTSTRSYTSPVRAAAAAEKRDRVLQVATDVLRESASATHFSLDAVAKIAGVTRLTVYNQF
GSRRGLLEAVFDSIALQGQLGRLRHVHAQPDPREGIDLLIRICCDFWSSDPAVPRIYEAM
ASDVEFAQALTERNERRRQLIGTLVEKLSTKATRPQLRRDTVDFIFALTSFAMFRMLAPG
RSSDEVGELIRASAHAALERMAR