Protein Info for ABZR86_RS17940 in Dyella japonica UNC79MFTsu3.2

Annotation: FUSC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 30 to 49 (20 residues), see Phobius details amino acids 61 to 80 (20 residues), see Phobius details amino acids 86 to 102 (17 residues), see Phobius details amino acids 112 to 130 (19 residues), see Phobius details amino acids 137 to 160 (24 residues), see Phobius details amino acids 194 to 213 (20 residues), see Phobius details amino acids 242 to 261 (20 residues), see Phobius details amino acids 271 to 301 (31 residues), see Phobius details amino acids 321 to 338 (18 residues), see Phobius details PF13515: FUSC_2" amino acids 203 to 330 (128 residues), 47.9 bits, see alignment E=7.5e-17

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2J2J7 at UniProt or InterPro

Protein Sequence (457 amino acids)

>ABZR86_RS17940 FUSC family protein (Dyella japonica UNC79MFTsu3.2)
MPSTTALLRALVEALATLLAAIATMLCTWVAAPGPGPAVLAVVLCLSLSRSQLDRDLRGR
LEAAVVLPLVGLVALGVGLLLRHWPWAGAAVFVAGMFVSIWLRRFGAMARRAGGLIALPF
VTLLTVPHVQPTANGVLPVWLVPIVVALLALFWVSMLHLLVRRLRIRPPVDEDDAPIAIP
ATQDRPGLAVSTRMAIQMAVALAVSFALGFLFFRERWGWIVLTAFIVNSGNRGRLDVVYK
SGMRVLGAAVGTAIALGLGQHLGVDRHTSPILMLTALFLGVWLRPFGYAWWALFVTLALA
LLQGFGGGEPTGLLWQRMEEIVLGAIVGIAAAWWVLPVRSTDVLRRRLADALAALSEALD
PATEQRSAARFTAALDRVEEVTPPFRAARLLLRRRAMHPADWADTLLDCREPAKALIDQG
ATPGRLRQAVGAARRALREPDTLLPLLRALRADLRSG