Protein Info for ABZR86_RS17730 in Dyella japonica UNC79MFTsu3.2

Annotation: aldo/keto reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 transmembrane" amino acids 208 to 226 (19 residues), see Phobius details PF00248: Aldo_ket_red" amino acids 15 to 315 (301 residues), 241.6 bits, see alignment E=5.1e-76

Best Hits

KEGG orthology group: None (inferred from 84% identity to xfa:XF1724)

MetaCyc: 51% identical to dTDP-(2R,6S)-6-hydroxy-2-methyl-3-oxo-3,6-dihydro-2H-pyran-4-olate 3-ketoreductase (dTDP-4-dehydro-2,6-dideoxy-alpha-D-allose-forming) (Saccharopolyspora erythraea NRRL 2338)
1.17.1.-

Predicted SEED Role

"sugar-phosphate dehydrogenase"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2J1Z0 at UniProt or InterPro

Protein Sequence (328 amino acids)

>ABZR86_RS17730 aldo/keto reductase (Dyella japonica UNC79MFTsu3.2)
MDYAHLGRTGLKVSRLSLGTMNFGELTDEATSFAIMDEALHTGINFFDTADVYGGPQTPD
MEKGFGTSEEIIGRWLAKGGHRDRIVLATKVYQPMDIGPNDKYLSAYHIRRACEASLRRL
KTDHIDLYQMHHVDRATPWEEIWQAMEQLIREGKITYVGSSNFAGWDIATAQCMANARHT
LGLASEQSLYNLTQRTIELEVIPALRHFGIGLIPWSPIGMGLLGGVLRKISDGRRATPHL
QQRIAQLRPQLEAYEKLCDDIGEAPSDVALAWLLHQPVVTTVISGPRTVEQLRQNLKAPS
LSLSDETLARLDEIWPGPGGEAPAAYAW