Protein Info for ABZR86_RS17720 in Dyella japonica UNC79MFTsu3.2

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 38 to 355 (318 residues), 206.4 bits, see alignment E=2.7e-65 PF13533: Biotin_lipoyl_2" amino acids 64 to 111 (48 residues), 24.4 bits, see alignment 3e-09 PF16576: HlyD_D23" amino acids 65 to 275 (211 residues), 51 bits, see alignment E=1.8e-17 PF13437: HlyD_3" amino acids 175 to 266 (92 residues), 53.5 bits, see alignment E=5.3e-18

Best Hits

KEGG orthology group: None (inferred from 54% identity to rsl:RPSI07_mp0539)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2J4K8 at UniProt or InterPro

Protein Sequence (367 amino acids)

>ABZR86_RS17720 efflux RND transporter periplasmic adaptor subunit (Dyella japonica UNC79MFTsu3.2)
MAAIVAIVAAVAGVGIWRGAHGRADVTSGGDATRALTVEIVAPELRTWPGTEQASGPVTA
WQEVIVSPETGGLRIADLQVDVGARVKRGQLLASLADDSLRTDLHKQEALLAQANASLEQ
AVSNLRRAQMVGDSGGLSPQQLEEYRINEATARASMRSAKADVDSVQLKLRQSRVVAPDD
GIVSSKSAVLGNVVSAGAEMFRLIRQGRLEWRPEVDARQLNAIHVGQLADVMLPSGQHVQ
GRIREIGPALSTDTGRATIYVSLPADSAARQGMFANGAIEYESRAATTLPQSAVVPRDGR
SYVYMVDANGRVSSRAVDTGRRSGDRIEILTAMDKGARVVASGGAFLSEDAIVDVVPATR
DKARSAP