Protein Info for ABZR86_RS17550 in Dyella japonica UNC79MFTsu3.2

Annotation: adenosylcobalamin-dependent ribonucleoside-diphosphate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00317: Ribonuc_red_lgN
  • amino acids 25 to 96 (72 residues), 32.3 bits, E=8.6e-12
• TIGR02504: ribonucleoside-diphosphate reductase, adenosylcobalamin-dependent
  • amino acids 29 to 664 (636 residues), 582 bits, E=7.6e-179
• PF02867: Ribonuc_red_lgC
  • amino acids 109 to 655 (547 residues), 423.9 bits, E=9.4e-131

Best Hits

KEGG orthology group: K00525, ribonucleoside-diphosphate reductase alpha chain [EC: 1.17.4.1] (inferred from 82% identity to psu:Psesu_2614)

Predicted SEED Role

"Ribonucleotide reductase of class II (coenzyme B12-dependent) (EC 1.17.4.1)" in subsystem Ribonucleotide reduction (EC 1.17.4.1)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
• superpathway of purine nucleotide salvage (12/14 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (8/9 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (6/7 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis II (6/7 steps found)
• adenosine deoxyribonucleotides de novo biosynthesis I (2/2 steps found)
• guanosine deoxyribonucleotides de novo biosynthesis I (2/2 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (6/8 steps found)
• adenosine deoxyribonucleotides de novo biosynthesis II (3/4 steps found)
• guanosine deoxyribonucleotides de novo biosynthesis II (3/4 steps found)

KEGG Metabolic Maps

• Glutathione metabolism
• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.17.4.1

Use Curated BLAST to search for 1.17.4.1

Sequence Analysis Tools

See A0A1I2IY97 at UniProt or InterPro

Protein Sequence (720 amino acids)

>ABZR86_RS17550 adenosylcobalamin-dependent ribonucleoside-diphosphate reductase (Dyella japonica UNC79MFTsu3.2)
MSTVRAPAVGAEINRDGVAMIPLQPASYDIWDKKYRLKAKSGDPVDGSVDETYQRVARAL
SEVEATPELRQHWFERFLWALRRGAIPAGRITSNAGALEHKPATSTINCTVSGTITDSMD
DILEKVHEAGLTLKAGCGIGYEFSTLRPRGAYVSGAGAYTSGPLSFMDIYDKMCFTVSSA
GGRRGAQMGTFDVSHPDVKEFIRAKREDGRLRQFNLSLLITDGFMQAVEHDHDWPMVFPV
HVKEQDEIDLTDPAKVVWREWPTHQNYVSREDGLVACKIYGHIRARHLWDMIMVSTYDYA
EPGFILIDKVNEMNNNWWCEHIRATNPCGEQPLPPYGSCLLGSINLTTFVRDPFGPKARF
DWDEYREVVKVFTRMLDNVVEINGLPLEQQRHEILSKRRHGMGFLGLGSTITMLKMRYGN
ADAVAFTEDVSREMAVAGWEVALDLAKEKGPAPILAQDFTVTGDMLRKRPEMAADGWKVG
DAIPGRVLHAKYSRYMQRVASVAPNLVAELAEVGARFTHHSSIAPTGTISLSLANNASNG
IEPSFAHHYSRNVIREGRKTKEKIEVYSYELLAYRGLINAAAVPFSDDPQAKLPDYFVAA
DDITPKEHVDIQAASQKWIDSSISKTANVPTDYPYEDFKDIYFYAYKQGLKGCTTFRFNP
AAFQGVLVKEADLESTLYRFELEDGSVIELKGNEEVEYDGELHTAANLFDALKEGYYGKF