Protein Info for ABZR86_RS17480 in Dyella japonica UNC79MFTsu3.2

Annotation: lytic murein transglycosylase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13406: SLT_2
  • amino acids 36 to 323 (288 residues), 295.1 bits, E=2.8e-92
• TIGR02282: lytic murein transglycosylase B
  • amino acids 37 to 325 (289 residues), 323.3 bits, E=6.2e-101

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase B precursor (EC 3.2.1.-)" in subsystem Peptidoglycan Biosynthesis (EC 3.2.1.-)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Glycosaminoglycan degradation
• Nucleotide sugars metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

See A0A1I2JWU2 at UniProt or InterPro

Protein Sequence (336 amino acids)

>ABZR86_RS17480 lytic murein transglycosylase B (Dyella japonica UNC79MFTsu3.2)
MTEIAMPRPLQWIAALGLAAAAALTSAQAQTHPGQAQLVAEVAKETGKDPSTLNSLLDGA
KKQQSILDAISRPAEAKPWKDYRPIFLTDKRIDEGVAFYLEHRDLVERIGKQYGVAPEYI
VAIVGVETFYGRNTGKYKVLDALVTLGLYYPPRAAFFREQLKVLLSLPDSMLGGPLDKLV
GSYAGAQGWGQFMPSSIRDFGVDEDGDGHIDLHDSLPDILGSVANYFARHGWVSGGPVVA
RAQPDAAARPIQVKDSKPQWPLEQLMAWGYAPLQPMNPGQPSSLQTLEGPNGPEYWFTFQ
NFYVITKYNRSPLYALAVHQLAQAIAEGVREREATR