Protein Info for ABZR86_RS17455 in Dyella japonica UNC79MFTsu3.2

Annotation: rod shape-determining protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 TIGR00904: cell shape determining protein, MreB/Mrl family" amino acids 9 to 340 (332 residues), 528.8 bits, see alignment E=2.6e-163 PF06723: MreB_Mbl" amino acids 10 to 339 (330 residues), 493 bits, see alignment E=8.3e-152 PF00012: HSP70" amino acids 90 to 329 (240 residues), 52.3 bits, see alignment E=7.4e-18 PF14450: FtsA" amino acids 163 to 321 (159 residues), 45.8 bits, see alignment E=2e-15

Best Hits

Swiss-Prot: 79% identical to MREB_SALTY: Cell shape-determining protein MreB (mreB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03569, rod shape-determining protein MreB and related proteins (inferred from 84% identity to xcc:XCC3470)

Predicted SEED Role

"Rod shape-determining protein MreB" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2JVS2 at UniProt or InterPro

Protein Sequence (348 amino acids)

>ABZR86_RS17455 rod shape-determining protein (Dyella japonica UNC79MFTsu3.2)
MFKKFRGIFSNDISIDLGTANTLIYVRGQGIVLNEPSVVAIRQDRGPGGPRAVAAVGSDA
KKMLGRTPGNIATVRPMKDGVIANFSMTEAMLQHFIKQVHRSRLLRPSPRVLVCVPCGST
QVERRAIKESAEGAGARDVFLIEEPMAAAIGAGIPVHEARGSMVLDIGGGTSEVAVISLN
GIVYSQSVRVGGDRFDEAIINYVRRNHGTLIGESTAERIKMEIGCAFPQTHVREIEISGR
NLAEGVPRMFTINSNEVLEALHEPLSGIVAAVKSALEQTPPELCSDVAERGIVLTGGGAL
LRDLDRLISEETGLHVMVAEEPLTCVARGGGKALELIDQHGSDFFAAE