Protein Info for ABZR86_RS17390 in Dyella japonica UNC79MFTsu3.2

Annotation: VOC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00903: Glyoxalase
  • amino acids 4 to 113 (110 residues), 67.5 bits, E=1.4e-22
• PF13669: Glyoxalase_4
  • amino acids 7 to 103 (97 residues), 36.1 bits, E=7.2e-13

Best Hits

Swiss-Prot: 41% identical to LGUL_SYNY3: Probable lactoylglutathione lyase (gloA) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K01759, lactoylglutathione lyase [EC: 4.4.1.5] (inferred from 76% identity to xal:XALc_0775)

MetaCyc: 34% identical to lactoylglutathione lyase (Escherichia coli K-12 substr. MG1655)
Lactoylglutathione lyase. [EC: 4.4.1.5]

Predicted SEED Role

"Lactoylglutathione lyase (EC 4.4.1.5)" in subsystem Glutathione: Non-redox reactions or Methylglyoxal Metabolism (EC 4.4.1.5)

MetaCyc Pathways

• methylglyoxal degradation I (2/3 steps found)
• methylglyoxal degradation VIII (2/3 steps found)
• superpathway of methylglyoxal degradation (4/8 steps found)

KEGG Metabolic Maps

• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.5

Sequence Analysis Tools

See A0A1I2JYB6 at UniProt or InterPro

Protein Sequence (140 amino acids)

>ABZR86_RS17390 VOC family protein (Dyella japonica UNC79MFTsu3.2)
MKYLHSMVRVRDVDASLRFFCDGLGLQETRRMESAAGKFTLIYLAAPASPEAEVELTYNW
DSDEDYGSARNFGHLAFEVDDIYRTCRHLQDLGYTINRPPRDGHMAFVRSPDLISIELLQ
RDGRLPPQEPWASMPNTGVW